Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 9,171
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 8,967
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 8,883
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,777
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,374
  6. Avatar for Protein structural analysis room Japan 16. Protein structural analysis room Japan 1 pt. 8,186
  7. Avatar for Wright Biology SBI4U 17. Wright Biology SBI4U 1 pt. 5,857
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 3,129
  1. Avatar for JanTheConqueror 141. JanTheConqueror Lv 1 1 pt. 5,872
  2. Avatar for wrightbiology 142. wrightbiology Lv 1 1 pt. 5,857
  3. Avatar for Erikkka 143. Erikkka Lv 1 1 pt. 4,278
  4. Avatar for AllSeeingEye13 144. AllSeeingEye13 Lv 1 1 pt. 3,129
  5. Avatar for ROOZEBOOM 145. ROOZEBOOM Lv 1 1 pt. 3,129
  6. Avatar for kotenok2000 146. kotenok2000 Lv 1 1 pt. 3,129
  7. Avatar for Diana200816 147. Diana200816 Lv 1 1 pt. 3,129
  8. Avatar for fpc 148. fpc Lv 1 1 pt. 3,129
  9. Avatar for RAH 149. RAH Lv 1 1 pt. 3,129
  10. Avatar for _markus0255 150. _markus0255 Lv 1 1 pt. 3,129

Comments