Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 9,171
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 8,967
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 8,883
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,777
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,374
  6. Avatar for Protein structural analysis room Japan 16. Protein structural analysis room Japan 1 pt. 8,186
  7. Avatar for Wright Biology SBI4U 17. Wright Biology SBI4U 1 pt. 5,857
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 3,129
  1. Avatar for alcor29 31. alcor29 Lv 1 34 pts. 9,709
  2. Avatar for Satina 32. Satina Lv 1 33 pts. 9,689
  3. Avatar for infjamc 33. infjamc Lv 1 32 pts. 9,597
  4. Avatar for PeterDav 34. PeterDav Lv 1 30 pts. 9,555
  5. Avatar for jamiexq 35. jamiexq Lv 1 29 pts. 9,544
  6. Avatar for heather-1 36. heather-1 Lv 1 28 pts. 9,540
  7. Avatar for zippyc137 37. zippyc137 Lv 1 27 pts. 9,524
  8. Avatar for akaaka 38. akaaka Lv 1 26 pts. 9,499
  9. Avatar for NPrincipi 39. NPrincipi Lv 1 25 pts. 9,463
  10. Avatar for latin krepin 40. latin krepin Lv 1 24 pts. 9,452

Comments