Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241

  1. Avatar for alcor29 31. alcor29 Lv 1 34 pts. 9,709
  2. Avatar for Satina 32. Satina Lv 1 33 pts. 9,689
  3. Avatar for infjamc 33. infjamc Lv 1 32 pts. 9,597
  4. Avatar for PeterDav 34. PeterDav Lv 1 30 pts. 9,555
  5. Avatar for jamiexq 35. jamiexq Lv 1 29 pts. 9,544
  6. Avatar for heather-1 36. heather-1 Lv 1 28 pts. 9,540
  7. Avatar for zippyc137 37. zippyc137 Lv 1 27 pts. 9,524
  8. Avatar for akaaka 38. akaaka Lv 1 26 pts. 9,499
  9. Avatar for NPrincipi 39. NPrincipi Lv 1 25 pts. 9,463
  10. Avatar for latin krepin 40. latin krepin Lv 1 24 pts. 9,452

Comments