Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Australia 11. Australia 2 pts. 9,171
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 8,967
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 8,883
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,777
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,374
  6. Avatar for Wright Biology SBI4U 17. Wright Biology SBI4U 1 pt. 5,857
  7. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 3,129

  1. Avatar for maithra 41. maithra Lv 1 23 pts. 9,416
  2. Avatar for BarrySampson 42. BarrySampson Lv 1 22 pts. 9,339
  3. Avatar for equilibria 43. equilibria Lv 1 21 pts. 9,314
  4. Avatar for phi16 44. phi16 Lv 1 20 pts. 9,282
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 19 pts. 9,279
  6. Avatar for Simek 46. Simek Lv 1 18 pts. 9,273
  7. Avatar for Grom 47. Grom Lv 1 17 pts. 9,241
  8. Avatar for AlkiP0Ps 48. AlkiP0Ps Lv 1 17 pts. 9,171
  9. Avatar for Pexiixep 49. Pexiixep Lv 1 16 pts. 9,164
  10. Avatar for Oransche 50. Oransche Lv 1 15 pts. 9,145

Comments