Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241

  1. Avatar for maithra 41. maithra Lv 1 23 pts. 9,416
  2. Avatar for BarrySampson 42. BarrySampson Lv 1 22 pts. 9,339
  3. Avatar for equilibria 43. equilibria Lv 1 21 pts. 9,314
  4. Avatar for phi16 44. phi16 Lv 1 20 pts. 9,282
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 19 pts. 9,279
  6. Avatar for Simek 46. Simek Lv 1 18 pts. 9,273
  7. Avatar for Grom 47. Grom Lv 1 17 pts. 9,241
  8. Avatar for AlkiP0Ps 48. AlkiP0Ps Lv 1 17 pts. 9,171
  9. Avatar for Pexiixep 49. Pexiixep Lv 1 16 pts. 9,164
  10. Avatar for Oransche 50. Oransche Lv 1 15 pts. 9,145

Comments