Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for Spedington 101. Spedington Lv 1 2 pts. 8,587
  2. Avatar for evifnoskcaj 102. evifnoskcaj Lv 1 2 pts. 8,561
  3. Avatar for JordiR 103. JordiR Lv 1 2 pts. 8,539
  4. Avatar for iGC 104. iGC Lv 1 2 pts. 8,537
  5. Avatar for Hebrew Hitman 105. Hebrew Hitman Lv 1 2 pts. 8,535
  6. Avatar for joshmiller 106. joshmiller Lv 1 2 pts. 8,528
  7. Avatar for EKhem 107. EKhem Lv 1 2 pts. 8,519
  8. Avatar for Swapper242 108. Swapper242 Lv 1 1 pt. 8,488
  9. Avatar for Mohoernchen 109. Mohoernchen Lv 1 1 pt. 8,472
  10. Avatar for jaswa2022 110. jaswa2022 Lv 1 1 pt. 8,431

Comments