Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for Spedington 101. Spedington Lv 1 2 pts. 8,587
  2. Avatar for evifnoskcaj 102. evifnoskcaj Lv 1 2 pts. 8,561
  3. Avatar for JordiR 103. JordiR Lv 1 2 pts. 8,539
  4. Avatar for iGC 104. iGC Lv 1 2 pts. 8,537
  5. Avatar for Hebrew Hitman 105. Hebrew Hitman Lv 1 2 pts. 8,535
  6. Avatar for joshmiller 106. joshmiller Lv 1 2 pts. 8,528
  7. Avatar for EKhem 107. EKhem Lv 1 2 pts. 8,519
  8. Avatar for Swapper242 108. Swapper242 Lv 1 1 pt. 8,488
  9. Avatar for Mohoernchen 109. Mohoernchen Lv 1 1 pt. 8,472
  10. Avatar for jaswa2022 110. jaswa2022 Lv 1 1 pt. 8,431

Comments