Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for diego12312 111. diego12312 Lv 1 1 pt. 8,410
  2. Avatar for ivalnic 112. ivalnic Lv 1 1 pt. 8,410
  3. Avatar for McFold 113. McFold Lv 1 1 pt. 8,388
  4. Avatar for furi0us 114. furi0us Lv 1 1 pt. 8,381
  5. Avatar for foxylagatija 115. foxylagatija Lv 1 1 pt. 8,355
  6. Avatar for ADMIN K 116. ADMIN K Lv 1 1 pt. 8,310
  7. Avatar for jfungafat 117. jfungafat Lv 1 1 pt. 8,300
  8. Avatar for DipsyDoodle2016 118. DipsyDoodle2016 Lv 1 1 pt. 8,287
  9. Avatar for ForPatri 119. ForPatri Lv 1 1 pt. 8,285
  10. Avatar for LELE1964 120. LELE1964 Lv 1 1 pt. 8,202

Comments