Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570

  1. Avatar for diego12312 111. diego12312 Lv 1 1 pt. 8,410
  2. Avatar for ivalnic 112. ivalnic Lv 1 1 pt. 8,410
  3. Avatar for McFold 113. McFold Lv 1 1 pt. 8,388
  4. Avatar for furi0us 114. furi0us Lv 1 1 pt. 8,381
  5. Avatar for foxylagatija 115. foxylagatija Lv 1 1 pt. 8,355
  6. Avatar for ADMIN K 116. ADMIN K Lv 1 1 pt. 8,310
  7. Avatar for jfungafat 117. jfungafat Lv 1 1 pt. 8,300
  8. Avatar for DipsyDoodle2016 118. DipsyDoodle2016 Lv 1 1 pt. 8,287
  9. Avatar for ForPatri 119. ForPatri Lv 1 1 pt. 8,285
  10. Avatar for LELE1964 120. LELE1964 Lv 1 1 pt. 8,202

Comments