Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for Dr.Gonzo 121. Dr.Gonzo Lv 1 1 pt. 8,200
  2. Avatar for biologist666 122. biologist666 Lv 1 1 pt. 8,139
  3. Avatar for zo3xiaJonWeinberg 123. zo3xiaJonWeinberg Lv 1 1 pt. 8,075
  4. Avatar for liaquatali 124. liaquatali Lv 1 1 pt. 8,047
  5. Avatar for Aday Devora 125. Aday Devora Lv 1 1 pt. 7,975
  6. Avatar for Dr. Sigma 126. Dr. Sigma Lv 1 1 pt. 7,881
  7. Avatar for protein_crown13 127. protein_crown13 Lv 1 1 pt. 7,865
  8. Avatar for proteinninja5 128. proteinninja5 Lv 1 1 pt. 7,826
  9. Avatar for isomorfismouniversal 129. isomorfismouniversal Lv 1 1 pt. 7,731
  10. Avatar for rezaefar 130. rezaefar Lv 1 1 pt. 7,687

Comments