Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for Dr.Gonzo 121. Dr.Gonzo Lv 1 1 pt. 8,200
  2. Avatar for biologist666 122. biologist666 Lv 1 1 pt. 8,139
  3. Avatar for zo3xiaJonWeinberg 123. zo3xiaJonWeinberg Lv 1 1 pt. 8,075
  4. Avatar for liaquatali 124. liaquatali Lv 1 1 pt. 8,047
  5. Avatar for Aday Devora 125. Aday Devora Lv 1 1 pt. 7,975
  6. Avatar for Dr. Sigma 126. Dr. Sigma Lv 1 1 pt. 7,881
  7. Avatar for protein_crown13 127. protein_crown13 Lv 1 1 pt. 7,865
  8. Avatar for proteinninja5 128. proteinninja5 Lv 1 1 pt. 7,826
  9. Avatar for isomorfismouniversal 129. isomorfismouniversal Lv 1 1 pt. 7,731
  10. Avatar for rezaefar 130. rezaefar Lv 1 1 pt. 7,687

Comments