Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for Joscan 161. Joscan Lv 1 1 pt. 5,122
  2. Avatar for shahireh.r 162. shahireh.r Lv 1 1 pt. 5,122
  3. Avatar for mcwhite84 163. mcwhite84 Lv 1 1 pt. 5,122
  4. Avatar for sean1031 164. sean1031 Lv 1 1 pt. 5,122
  5. Avatar for Arodys 165. Arodys Lv 1 1 pt. 5,122
  6. Avatar for fculp 166. fculp Lv 1 1 pt. 5,122
  7. Avatar for walkeram 167. walkeram Lv 1 1 pt. 5,122
  8. Avatar for castroame 168. castroame Lv 1 1 pt. 5,122
  9. Avatar for celinagopie 169. celinagopie Lv 1 1 pt. 5,122
  10. Avatar for joshjoshtesttest 170. joshjoshtesttest Lv 1 1 pt. 5,122

Comments