Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for Joscan 161. Joscan Lv 1 1 pt. 5,122
  2. Avatar for shahireh.r 162. shahireh.r Lv 1 1 pt. 5,122
  3. Avatar for mcwhite84 163. mcwhite84 Lv 1 1 pt. 5,122
  4. Avatar for sean1031 164. sean1031 Lv 1 1 pt. 5,122
  5. Avatar for Arodys 165. Arodys Lv 1 1 pt. 5,122
  6. Avatar for fculp 166. fculp Lv 1 1 pt. 5,122
  7. Avatar for walkeram 167. walkeram Lv 1 1 pt. 5,122
  8. Avatar for castroame 168. castroame Lv 1 1 pt. 5,122
  9. Avatar for celinagopie 169. celinagopie Lv 1 1 pt. 5,122
  10. Avatar for joshjoshtesttest 170. joshjoshtesttest Lv 1 1 pt. 5,122

Comments