Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for MicElephant 11. MicElephant Lv 1 75 pts. 10,388
  2. Avatar for Simek 12. Simek Lv 1 73 pts. 10,384
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 71 pts. 10,374
  4. Avatar for gmn 14. gmn Lv 1 69 pts. 10,366
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 67 pts. 10,364
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 65 pts. 10,359
  7. Avatar for Phyx 17. Phyx Lv 1 63 pts. 10,334
  8. Avatar for borattt 18. borattt Lv 1 61 pts. 10,324
  9. Avatar for RockOn 19. RockOn Lv 1 59 pts. 10,315
  10. Avatar for fpc 20. fpc Lv 1 57 pts. 10,312

Comments