Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for MicElephant 11. MicElephant Lv 1 75 pts. 10,388
  2. Avatar for Simek 12. Simek Lv 1 73 pts. 10,384
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 71 pts. 10,374
  4. Avatar for gmn 14. gmn Lv 1 69 pts. 10,366
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 67 pts. 10,364
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 65 pts. 10,359
  7. Avatar for Phyx 17. Phyx Lv 1 63 pts. 10,334
  8. Avatar for borattt 18. borattt Lv 1 61 pts. 10,324
  9. Avatar for RockOn 19. RockOn Lv 1 59 pts. 10,315
  10. Avatar for fpc 20. fpc Lv 1 57 pts. 10,312

Comments