Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for PeterDav 41. PeterDav Lv 1 28 pts. 10,043
  2. Avatar for NPrincipi 42. NPrincipi Lv 1 27 pts. 9,970
  3. Avatar for maithra 43. maithra Lv 1 26 pts. 9,960
  4. Avatar for ProfVince 44. ProfVince Lv 1 25 pts. 9,959
  5. Avatar for latin krepin 45. latin krepin Lv 1 24 pts. 9,953
  6. Avatar for kyoota 46. kyoota Lv 1 24 pts. 9,892
  7. Avatar for Zosa 47. Zosa Lv 1 23 pts. 9,867
  8. Avatar for alcor29 48. alcor29 Lv 1 22 pts. 9,865
  9. Avatar for heather-1 49. heather-1 Lv 1 21 pts. 9,855
  10. Avatar for pfirth 50. pfirth Lv 1 20 pts. 9,847

Comments