Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for PeterDav 41. PeterDav Lv 1 28 pts. 10,043
  2. Avatar for NPrincipi 42. NPrincipi Lv 1 27 pts. 9,970
  3. Avatar for maithra 43. maithra Lv 1 26 pts. 9,960
  4. Avatar for ProfVince 44. ProfVince Lv 1 25 pts. 9,959
  5. Avatar for latin krepin 45. latin krepin Lv 1 24 pts. 9,953
  6. Avatar for kyoota 46. kyoota Lv 1 24 pts. 9,892
  7. Avatar for Zosa 47. Zosa Lv 1 23 pts. 9,867
  8. Avatar for alcor29 48. alcor29 Lv 1 22 pts. 9,865
  9. Avatar for heather-1 49. heather-1 Lv 1 21 pts. 9,855
  10. Avatar for pfirth 50. pfirth Lv 1 20 pts. 9,847

Comments