Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for leithw2 81. leithw2 Lv 1 5 pts. 9,038
  2. Avatar for Dancio 82. Dancio Lv 1 5 pts. 8,997
  3. Avatar for ume 83. ume Lv 1 5 pts. 8,991
  4. Avatar for jawz101 84. jawz101 Lv 1 5 pts. 8,961
  5. Avatar for kludbrook 85. kludbrook Lv 1 5 pts. 8,887
  6. Avatar for drumpeter18yrs9yrs 86. drumpeter18yrs9yrs Lv 1 4 pts. 8,880
  7. Avatar for Hellcat6 87. Hellcat6 Lv 1 4 pts. 8,879
  8. Avatar for cherry39 88. cherry39 Lv 1 4 pts. 8,856
  9. Avatar for Cjh321 89. Cjh321 Lv 1 4 pts. 8,839
  10. Avatar for irenagrocka 90. irenagrocka Lv 1 4 pts. 8,819

Comments