Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for leithw2 81. leithw2 Lv 1 5 pts. 9,038
  2. Avatar for Dancio 82. Dancio Lv 1 5 pts. 8,997
  3. Avatar for ume 83. ume Lv 1 5 pts. 8,991
  4. Avatar for jawz101 84. jawz101 Lv 1 5 pts. 8,961
  5. Avatar for kludbrook 85. kludbrook Lv 1 5 pts. 8,887
  6. Avatar for drumpeter18yrs9yrs 86. drumpeter18yrs9yrs Lv 1 4 pts. 8,880
  7. Avatar for Hellcat6 87. Hellcat6 Lv 1 4 pts. 8,879
  8. Avatar for cherry39 88. cherry39 Lv 1 4 pts. 8,856
  9. Avatar for Cjh321 89. Cjh321 Lv 1 4 pts. 8,839
  10. Avatar for irenagrocka 90. irenagrocka Lv 1 4 pts. 8,819

Comments