Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 55 pts. 10,297
  2. Avatar for Idiotboy 22. Idiotboy Lv 1 54 pts. 10,294
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 52 pts. 10,287
  4. Avatar for jobo0502 24. jobo0502 Lv 1 50 pts. 10,275
  5. Avatar for guineapig 25. guineapig Lv 1 49 pts. 10,249
  6. Avatar for Skippysk8s 26. Skippysk8s Lv 1 47 pts. 10,244
  7. Avatar for akaaka 27. akaaka Lv 1 46 pts. 10,237
  8. Avatar for Vinara 28. Vinara Lv 1 44 pts. 10,212
  9. Avatar for jamiexq 29. jamiexq Lv 1 43 pts. 10,178
  10. Avatar for Visok 30. Visok Lv 1 41 pts. 10,170

Comments