Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,278
  2. Avatar for Go Science 2. Go Science 74 pts. 11,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,233
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,219
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,029
  6. Avatar for Contenders 6. Contenders 18 pts. 11,018
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,013
  8. Avatar for Australia 8. Australia 8 pts. 10,255
  9. Avatar for Foldit Staff 9. Foldit Staff 5 pts. 9,515
  10. Avatar for BIOF215 10. BIOF215 3 pts. 9,452
  1. Avatar for christinem129 141. christinem129 Lv 1 1 pt. 6,504
  2. Avatar for Frank Madu 142. Frank Madu Lv 1 1 pt. 6,465
  3. Avatar for Edmond273 143. Edmond273 Lv 1 1 pt. 6,428
  4. Avatar for 782174849 144. 782174849 Lv 1 1 pt. 6,383
  5. Avatar for thinguyen94 145. thinguyen94 Lv 1 1 pt. 6,354
  6. Avatar for Anna Toon 146. Anna Toon Lv 1 1 pt. 6,352
  7. Avatar for THESEBASXD213 147. THESEBASXD213 Lv 1 1 pt. 6,349
  8. Avatar for Emily_Lemieux 148. Emily_Lemieux Lv 1 1 pt. 6,348
  9. Avatar for Huang T 149. Huang T Lv 1 1 pt. 6,348
  10. Avatar for shreyasfoldit 150. shreyasfoldit Lv 1 1 pt. 6,348

Comments