Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,278
  2. Avatar for Go Science 2. Go Science 74 pts. 11,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,233
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,219
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,029
  6. Avatar for Contenders 6. Contenders 18 pts. 11,018
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,013
  8. Avatar for Australia 8. Australia 8 pts. 10,255
  9. Avatar for Foldit Staff 9. Foldit Staff 5 pts. 9,515
  10. Avatar for BIOF215 10. BIOF215 3 pts. 9,452
  1. Avatar for furi0us 101. furi0us Lv 1 2 pts. 9,130
  2. Avatar for psmenon 102. psmenon Lv 1 2 pts. 9,098
  3. Avatar for artsyambie6 103. artsyambie6 Lv 1 2 pts. 9,093
  4. Avatar for pateya2022 104. pateya2022 Lv 1 2 pts. 9,092
  5. Avatar for shogi 105. shogi Lv 1 2 pts. 9,088
  6. Avatar for sherlomck_7 106. sherlomck_7 Lv 1 1 pt. 9,065
  7. Avatar for pfirth 107. pfirth Lv 1 1 pt. 9,029
  8. Avatar for txatlapS 108. txatlapS Lv 1 1 pt. 9,023
  9. Avatar for shreyaspawar 109. shreyaspawar Lv 1 1 pt. 9,021
  10. Avatar for zz123 110. zz123 Lv 1 1 pt. 8,974

Comments