Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,780
  2. Avatar for Contenders 2. Contenders 73 pts. 9,777
  3. Avatar for Go Science 3. Go Science 52 pts. 9,772
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,768
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,760
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 9,726
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,692
  8. Avatar for ProWigglers-AKLab 8. ProWigglers-AKLab 6 pts. 9,541
  9. Avatar for Australia 9. Australia 4 pts. 9,468
  10. Avatar for Ogre's lab 10. Ogre's lab 2 pts. 9,279
  1. Avatar for var.lau.2001 121. var.lau.2001 Lv 1 1 pt. 6,130
  2. Avatar for gauravkapali 122. gauravkapali Lv 1 1 pt. 4,067
  3. Avatar for ChristineJ 123. ChristineJ Lv 1 1 pt. 1,317
  4. Avatar for anahojan 124. anahojan Lv 1 1 pt. 1,289
  5. Avatar for wydia22 125. wydia22 Lv 1 1 pt. 1,289
  6. Avatar for opeile2022 126. opeile2022 Lv 1 1 pt. 1,289
  7. Avatar for aidencosta 127. aidencosta Lv 1 1 pt. 1,289
  8. Avatar for loony_toonie 128. loony_toonie Lv 1 1 pt. 1,289
  9. Avatar for Altercomp 129. Altercomp Lv 1 1 pt. 1,289
  10. Avatar for dboscombe 130. dboscombe Lv 1 1 pt. 1,289

Comments