Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,780
  2. Avatar for Contenders 2. Contenders 73 pts. 9,777
  3. Avatar for Go Science 3. Go Science 52 pts. 9,772
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,768
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,760
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 9,726
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,692
  8. Avatar for ProWigglers-AKLab 8. ProWigglers-AKLab 6 pts. 9,541
  9. Avatar for Australia 9. Australia 4 pts. 9,468
  10. Avatar for Ogre's lab 10. Ogre's lab 2 pts. 9,279
  1. Avatar for Deleted player 111. Deleted player 1 pt. 7,707
  2. Avatar for rmoretti 112. rmoretti Lv 1 1 pt. 7,701
  3. Avatar for jflat06 113. jflat06 Lv 1 1 pt. 7,387
  4. Avatar for the_cgm_baker 114. the_cgm_baker Lv 1 1 pt. 7,381
  5. Avatar for bljx200 115. bljx200 Lv 1 1 pt. 7,192
  6. Avatar for briroest 116. briroest Lv 1 1 pt. 7,112
  7. Avatar for tvo301 117. tvo301 Lv 1 1 pt. 6,962
  8. Avatar for juliocl 118. juliocl Lv 1 1 pt. 6,745
  9. Avatar for Matthew Gagnier 119. Matthew Gagnier Lv 1 1 pt. 6,729
  10. Avatar for interleukin 120. interleukin Lv 1 1 pt. 6,321

Comments