Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 9,910
  2. Avatar for G1051331 12. G1051331 1 pt. 9,550
  3. Avatar for Team China 13. Team China 1 pt. 9,452
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,638
  5. Avatar for Window Group 15. Window Group 1 pt. 8,210
  6. Avatar for UML BMEN.4100 16. UML BMEN.4100 1 pt. 8,165
  7. Avatar for Haykapnayan 17. Haykapnayan 1 pt. 8,165
  1. Avatar for pfirth 71. pfirth Lv 1 1 pt. 9,619
  2. Avatar for rinze 72. rinze Lv 1 1 pt. 9,606
  3. Avatar for DScott 73. DScott Lv 1 1 pt. 9,599
  4. Avatar for Mohoernchen 74. Mohoernchen Lv 1 1 pt. 9,553
  5. Avatar for pin.pab.2001 75. pin.pab.2001 Lv 1 1 pt. 9,550
  6. Avatar for Lynhn 76. Lynhn Lv 1 1 pt. 9,459
  7. Avatar for zo3xiaJonWeinberg 77. zo3xiaJonWeinberg Lv 1 1 pt. 9,452
  8. Avatar for cyshaw98 78. cyshaw98 Lv 1 1 pt. 9,449
  9. Avatar for Rensat 79. Rensat Lv 1 1 pt. 9,441
  10. Avatar for pruneau_44 80. pruneau_44 Lv 1 1 pt. 9,408

Comments