Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,178
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,171
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,148
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,120
  5. Avatar for Go Science 5. Go Science 27 pts. 10,113
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,111
  7. Avatar for Contenders 7. Contenders 12 pts. 10,081
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,002
  9. Avatar for AlphaFold 9. AlphaFold 5 pts. 9,902
  10. Avatar for Australia 10. Australia 3 pts. 9,549
  1. Avatar for infjamc 31. infjamc Lv 1 21 pts. 9,991
  2. Avatar for manu8170 32. manu8170 Lv 1 20 pts. 9,989
  3. Avatar for ProfVince 33. ProfVince Lv 1 19 pts. 9,986
  4. Avatar for Beany 34. Beany Lv 1 18 pts. 9,981
  5. Avatar for ucad 35. ucad Lv 1 17 pts. 9,980
  6. Avatar for Visok 36. Visok Lv 1 16 pts. 9,979
  7. Avatar for BootsMcGraw 37. BootsMcGraw Lv 1 15 pts. 9,961
  8. Avatar for fiendish_ghoul 38. fiendish_ghoul Lv 1 14 pts. 9,952
  9. Avatar for bamh 39. bamh Lv 1 13 pts. 9,947
  10. Avatar for NeLikomSheet 40. NeLikomSheet Lv 1 12 pts. 9,945

Comments