Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Team China 11. Team China 2 pts. 9,347
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,985
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 8,877
  4. Avatar for G1051331 14. G1051331 1 pt. 8,404
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,315
  6. Avatar for Window Group 16. Window Group 1 pt. 8,126
  7. Avatar for SHELL 17. SHELL 1 pt. 7,023
  8. Avatar for test 2 18. test 2 1 pt. 6,488
  1. Avatar for infjamc 31. infjamc Lv 1 21 pts. 9,991
  2. Avatar for manu8170 32. manu8170 Lv 1 20 pts. 9,989
  3. Avatar for ProfVince 33. ProfVince Lv 1 19 pts. 9,986
  4. Avatar for Beany 34. Beany Lv 1 18 pts. 9,981
  5. Avatar for ucad 35. ucad Lv 1 17 pts. 9,980
  6. Avatar for Visok 36. Visok Lv 1 16 pts. 9,979
  7. Avatar for BootsMcGraw 37. BootsMcGraw Lv 1 15 pts. 9,961
  8. Avatar for fiendish_ghoul 38. fiendish_ghoul Lv 1 14 pts. 9,952
  9. Avatar for bamh 39. bamh Lv 1 13 pts. 9,947
  10. Avatar for NeLikomSheet 40. NeLikomSheet Lv 1 12 pts. 9,945

Comments