Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,178
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,171
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,148
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,120
  5. Avatar for Go Science 5. Go Science 27 pts. 10,113
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,111
  7. Avatar for Contenders 7. Contenders 12 pts. 10,081
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,002
  9. Avatar for AlphaFold 9. AlphaFold 5 pts. 9,902
  10. Avatar for Australia 10. Australia 3 pts. 9,549
  1. Avatar for jflat06 101. jflat06 Lv 1 1 pt. 8,126
  2. Avatar for U202141865 102. U202141865 Lv 1 1 pt. 7,023
  3. Avatar for MarMo1061 103. MarMo1061 Lv 1 1 pt. 6,633
  4. Avatar for bonaan2022 104. bonaan2022 Lv 1 1 pt. 6,521
  5. Avatar for Elephant gamer 105. Elephant gamer Lv 1 1 pt. 6,488
  6. Avatar for Fisioact 106. Fisioact Lv 1 1 pt. 6,488
  7. Avatar for klbklb 107. klbklb Lv 1 1 pt. 6,488
  8. Avatar for joshtest01 108. joshtest01 Lv 1 1 pt. 6,488
  9. Avatar for UCNZ 109. UCNZ Lv 1 1 pt. 6,488
  10. Avatar for Sciren 110. Sciren Lv 1 1 pt. 6,488

Comments