Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,178
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,171
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,148
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,120
  5. Avatar for Go Science 5. Go Science 27 pts. 10,113
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,111
  7. Avatar for Contenders 7. Contenders 12 pts. 10,081
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,002
  9. Avatar for AlphaFold 9. AlphaFold 5 pts. 9,902
  10. Avatar for Australia 10. Australia 3 pts. 9,549
  1. Avatar for AlkiP0Ps 61. AlkiP0Ps Lv 1 3 pts. 9,549
  2. Avatar for carxo 62. carxo Lv 1 2 pts. 9,544
  3. Avatar for Hellcat6 63. Hellcat6 Lv 1 2 pts. 9,456
  4. Avatar for kitsoune 64. kitsoune Lv 1 2 pts. 9,416
  5. Avatar for kevin everington 65. kevin everington Lv 1 2 pts. 9,365
  6. Avatar for zo3xiaJonWeinberg 66. zo3xiaJonWeinberg Lv 1 2 pts. 9,347
  7. Avatar for Mohoernchen 67. Mohoernchen Lv 1 2 pts. 9,338
  8. Avatar for Merf 68. Merf Lv 1 1 pt. 9,336
  9. Avatar for DylanAAAaaa111 69. DylanAAAaaa111 Lv 1 1 pt. 9,329
  10. Avatar for Kiwegapa 70. Kiwegapa Lv 1 1 pt. 9,316

Comments