Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,178
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,171
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,148
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,120
  5. Avatar for Go Science 5. Go Science 27 pts. 10,113
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,111
  7. Avatar for Contenders 7. Contenders 12 pts. 10,081
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,002
  9. Avatar for AlphaFold 9. AlphaFold 5 pts. 9,902
  10. Avatar for Australia 10. Australia 3 pts. 9,549
  1. Avatar for rinze 71. rinze Lv 1 1 pt. 9,261
  2. Avatar for GiletJaune 72. GiletJaune Lv 1 1 pt. 9,261
  3. Avatar for Larini 73. Larini Lv 1 1 pt. 9,257
  4. Avatar for karaidel 74. karaidel Lv 1 1 pt. 9,248
  5. Avatar for pruneau_44 75. pruneau_44 Lv 1 1 pt. 9,234
  6. Avatar for cekubalim 76. cekubalim Lv 1 1 pt. 9,185
  7. Avatar for MiracleOfSight 77. MiracleOfSight Lv 1 1 pt. 9,176
  8. Avatar for 42003157 78. 42003157 Lv 1 1 pt. 9,156
  9. Avatar for antibot215 79. antibot215 Lv 1 1 pt. 9,148
  10. Avatar for froschi2 80. froschi2 Lv 1 1 pt. 9,144

Comments