Icon representing a puzzle

2200: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 15, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,698
  2. Avatar for Contenders 2. Contenders 70 pts. 11,442
  3. Avatar for Go Science 3. Go Science 47 pts. 11,429
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 11,403
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 11,271
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 11,247
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,205
  8. Avatar for Gargleblasters 8. Gargleblasters 4 pts. 11,098
  9. Avatar for Australia 9. Australia 2 pts. 10,781
  10. Avatar for Ogre's lab 10. Ogre's lab 1 pt. 10,738
  1. Avatar for jausmh 51. jausmh Lv 1 2 pts. 10,802
  2. Avatar for manu8170 52. manu8170 Lv 1 2 pts. 10,791
  3. Avatar for roarshock 53. roarshock Lv 1 2 pts. 10,781
  4. Avatar for AlkiP0Ps 54. AlkiP0Ps Lv 1 2 pts. 10,781
  5. Avatar for Borets 55. Borets Lv 1 2 pts. 10,738
  6. Avatar for Wiz kid 56. Wiz kid Lv 1 1 pt. 10,729
  7. Avatar for Vinara 57. Vinara Lv 1 1 pt. 10,724
  8. Avatar for jinhd6 58. jinhd6 Lv 1 1 pt. 10,723
  9. Avatar for blazegeek 59. blazegeek Lv 1 1 pt. 10,719
  10. Avatar for Arne Heessels 60. Arne Heessels Lv 1 1 pt. 10,673

Comments