Icon representing a puzzle

2200: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 15, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,698
  2. Avatar for Contenders 2. Contenders 70 pts. 11,442
  3. Avatar for Go Science 3. Go Science 47 pts. 11,429
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 11,403
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 11,271
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 11,247
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,205
  8. Avatar for Gargleblasters 8. Gargleblasters 4 pts. 11,098
  9. Avatar for Australia 9. Australia 2 pts. 10,781
  10. Avatar for Ogre's lab 10. Ogre's lab 1 pt. 10,738
  1. Avatar for fiendish_ghoul 61. fiendish_ghoul Lv 1 1 pt. 10,670
  2. Avatar for Merf 62. Merf Lv 1 1 pt. 10,643
  3. Avatar for carxo 63. carxo Lv 1 1 pt. 10,595
  4. Avatar for CharaLilith 64. CharaLilith Lv 1 1 pt. 10,577
  5. Avatar for Larini 65. Larini Lv 1 1 pt. 10,563
  6. Avatar for jadephoenix 66. jadephoenix Lv 1 1 pt. 10,561
  7. Avatar for argyrw 67. argyrw Lv 1 1 pt. 10,468
  8. Avatar for frostschutz 68. frostschutz Lv 1 1 pt. 10,460
  9. Avatar for rinze 69. rinze Lv 1 1 pt. 10,436
  10. Avatar for riber79 70. riber79 Lv 1 1 pt. 10,434

Comments