Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Beginner

Summary

Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872
  1. Avatar for St. 91. St. Lv 1 1 pt. 6,166
  2. Avatar for s2021771 92. s2021771 Lv 1 1 pt. 6,153
  3. Avatar for Emman 93. Emman Lv 1 1 pt. 5,814
  4. Avatar for napat 94. napat Lv 1 1 pt. 5,752
  5. Avatar for Janine 95. Janine Lv 1 1 pt. 5,598
  6. Avatar for sugarplum 96. sugarplum Lv 1 1 pt. 5,247
  7. Avatar for ynsie 97. ynsie Lv 1 1 pt. 5,244
  8. Avatar for cherryb 98. cherryb Lv 1 1 pt. 5,072
  9. Avatar for FatimaSilva 99. FatimaSilva Lv 1 1 pt. 5,001
  10. Avatar for Sophia Dominique Amihan 100. Sophia Dominique Amihan Lv 1 1 pt. 4,566

Comments