Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Beginner

Summary

Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872
  1. Avatar for SuoFeng 101. SuoFeng Lv 1 1 pt. 3,872
  2. Avatar for Eva-Tigist 102. Eva-Tigist Lv 1 1 pt. 3,208
  3. Avatar for greg_marconnet 103. greg_marconnet Lv 1 1 pt. 2,682
  4. Avatar for Hyemi 104. Hyemi Lv 1 1 pt. 2,658
  5. Avatar for mikrokosam 105. mikrokosam Lv 1 1 pt. 2,532
  6. Avatar for bryand 106. bryand Lv 1 1 pt. 0
  7. Avatar for Lisa_brb 107. Lisa_brb Lv 1 1 pt. 0
  8. Avatar for wooyoungkim 108. wooyoungkim Lv 1 1 pt. 0
  9. Avatar for milop 109. milop Lv 1 1 pt. 0
  10. Avatar for Montse Bonet 110. Montse Bonet Lv 1 1 pt. 0

Comments