Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Beginner

Summary

Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872
  1. Avatar for Cyrelle 71. Cyrelle Lv 1 1 pt. 6,373
  2. Avatar for Connie Rose 72. Connie Rose Lv 1 1 pt. 6,321
  3. Avatar for Ephraim03 73. Ephraim03 Lv 1 1 pt. 6,318
  4. Avatar for qse3700 74. qse3700 Lv 1 1 pt. 6,313
  5. Avatar for MA_MAHUSAY 75. MA_MAHUSAY Lv 1 1 pt. 6,300
  6. Avatar for bblaycne 76. bblaycne Lv 1 1 pt. 6,287
  7. Avatar for JRCAP 77. JRCAP Lv 1 1 pt. 6,287
  8. Avatar for Hanxin1234 78. Hanxin1234 Lv 1 1 pt. 6,272
  9. Avatar for cache 79. cache Lv 1 1 pt. 6,266
  10. Avatar for Tina1515 80. Tina1515 Lv 1 1 pt. 6,254

Comments