Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Beginner

Summary

Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872
  1. Avatar for alyssatribaco 11. alyssatribaco Lv 1 63 pts. 7,765
  2. Avatar for 2021797 12. 2021797 Lv 1 60 pts. 7,746
  3. Avatar for jankristoffer 13. jankristoffer Lv 1 58 pts. 7,745
  4. Avatar for aestelle 14. aestelle Lv 1 55 pts. 7,718
  5. Avatar for Rujulie Barretto 15. Rujulie Barretto Lv 1 52 pts. 7,692
  6. Avatar for maeK 16. maeK Lv 1 50 pts. 7,633
  7. Avatar for anthony1 17. anthony1 Lv 1 47 pts. 7,627
  8. Avatar for Gnny18 18. Gnny18 Lv 1 45 pts. 7,611
  9. Avatar for nicolewong123 19. nicolewong123 Lv 1 42 pts. 7,610
  10. Avatar for 2021523 20. 2021523 Lv 1 40 pts. 7,561

Comments