Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Beginner

Summary

Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872
  1. Avatar for deemzoom 21. deemzoom Lv 1 38 pts. 7,557
  2. Avatar for JoshuaJ 22. JoshuaJ Lv 1 36 pts. 7,519
  3. Avatar for Gonzaga 23. Gonzaga Lv 1 34 pts. 7,518
  4. Avatar for Head Wolf 24. Head Wolf Lv 1 33 pts. 7,495
  5. Avatar for Briane Delo 25. Briane Delo Lv 1 31 pts. 7,494
  6. Avatar for ESNOWE 26. ESNOWE Lv 1 29 pts. 7,470
  7. Avatar for loisee 27. loisee Lv 1 28 pts. 7,413
  8. Avatar for EC2020431 28. EC2020431 Lv 1 26 pts. 7,391
  9. Avatar for KewkieBean01 29. KewkieBean01 Lv 1 25 pts. 7,363
  10. Avatar for diku012 30. diku012 Lv 1 23 pts. 7,266

Comments