Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since about 3 years ago

Beginner

Summary

Created
November 17, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,371
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 24 pts. 8,223
  3. Avatar for Rechenkraft.net 3. Rechenkraft.net 4 pts. 7,745
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 7,610
  5. Avatar for Team China 5. Team China 1 pt. 3,872
  1. Avatar for Tiffanatisk Alvor 31. Tiffanatisk Alvor Lv 1 22 pts. 7,191
  2. Avatar for slashthedragon 32. slashthedragon Lv 1 21 pts. 7,176
  3. Avatar for castlewoo 33. castlewoo Lv 1 19 pts. 7,024
  4. Avatar for fae 34. fae Lv 1 18 pts. 6,830
  5. Avatar for vic 35. vic Lv 1 17 pts. 6,774
  6. Avatar for Jeannvel 36. Jeannvel Lv 1 16 pts. 6,680
  7. Avatar for ralphlloydpioquinto 37. ralphlloydpioquinto Lv 1 15 pts. 6,647
  8. Avatar for s2021369 38. s2021369 Lv 1 14 pts. 6,647
  9. Avatar for lexiegeolingo 39. lexiegeolingo Lv 1 13 pts. 6,634
  10. Avatar for Villamor_20 40. Villamor_20 Lv 1 13 pts. 6,627

Comments