Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Team South Africa 11. Team South Africa 1 pt. 9,032
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,868
  3. Avatar for Team China 13. Team China 1 pt. 8,842
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 8,815
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,942
  1. Avatar for chyna_soquena 101. chyna_soquena Lv 1 1 pt. 8,565
  2. Avatar for voen 102. voen Lv 1 1 pt. 8,553
  3. Avatar for Alj_olivares 103. Alj_olivares Lv 1 1 pt. 8,553
  4. Avatar for kaye.lo 104. kaye.lo Lv 1 1 pt. 8,544
  5. Avatar for vincentlaurence 105. vincentlaurence Lv 1 1 pt. 8,544
  6. Avatar for princessmie_tuyor 106. princessmie_tuyor Lv 1 1 pt. 8,540
  7. Avatar for Jeannvel 107. Jeannvel Lv 1 1 pt. 8,537
  8. Avatar for jeanrogue 108. jeanrogue Lv 1 1 pt. 8,537
  9. Avatar for loisee 109. loisee Lv 1 1 pt. 8,533
  10. Avatar for blurshie 110. blurshie Lv 1 1 pt. 8,532

Comments