Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638

  1. Avatar for chyna_soquena 101. chyna_soquena Lv 1 1 pt. 8,565
  2. Avatar for voen 102. voen Lv 1 1 pt. 8,553
  3. Avatar for Alj_olivares 103. Alj_olivares Lv 1 1 pt. 8,553
  4. Avatar for kaye.lo 104. kaye.lo Lv 1 1 pt. 8,544
  5. Avatar for vincentlaurence 105. vincentlaurence Lv 1 1 pt. 8,544
  6. Avatar for princessmie_tuyor 106. princessmie_tuyor Lv 1 1 pt. 8,540
  7. Avatar for Jeannvel 107. Jeannvel Lv 1 1 pt. 8,537
  8. Avatar for jeanrogue 108. jeanrogue Lv 1 1 pt. 8,537
  9. Avatar for loisee 109. loisee Lv 1 1 pt. 8,533
  10. Avatar for blurshie 110. blurshie Lv 1 1 pt. 8,532

Comments