Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Team South Africa 11. Team South Africa 1 pt. 9,032
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,868
  3. Avatar for Team China 13. Team China 1 pt. 8,842
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 8,815
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,942
  1. Avatar for glockbaum 121. glockbaum Lv 1 1 pt. 8,459
  2. Avatar for Sammy3c2b1a0 122. Sammy3c2b1a0 Lv 1 1 pt. 8,457
  3. Avatar for ynsie 123. ynsie Lv 1 1 pt. 8,000
  4. Avatar for sugarplum 124. sugarplum Lv 1 1 pt. 7,595
  5. Avatar for Cyra_munoz 125. Cyra_munoz Lv 1 1 pt. 7,072
  6. Avatar for LaundryBot 126. LaundryBot Lv 1 1 pt. 4,927
  7. Avatar for Kassandra Gallenero 127. Kassandra Gallenero Lv 1 1 pt. 3,152
  8. Avatar for bkoep 128. bkoep Lv 1 1 pt. 2,942
  9. Avatar for Manonthemoon 129. Manonthemoon Lv 1 1 pt. 2,942

Comments