Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638
  1. Avatar for glockbaum 121. glockbaum Lv 1 1 pt. 8,459
  2. Avatar for Sammy3c2b1a0 122. Sammy3c2b1a0 Lv 1 1 pt. 8,457
  3. Avatar for ynsie 123. ynsie Lv 1 1 pt. 8,000
  4. Avatar for sugarplum 124. sugarplum Lv 1 1 pt. 7,595
  5. Avatar for Cyra_munoz 125. Cyra_munoz Lv 1 1 pt. 7,072
  6. Avatar for LaundryBot 126. LaundryBot Lv 1 1 pt. 4,927
  7. Avatar for Kassandra Gallenero 127. Kassandra Gallenero Lv 1 1 pt. 3,152
  8. Avatar for bkoep 128. bkoep Lv 1 1 pt. 2,942
  9. Avatar for Manonthemoon 129. Manonthemoon Lv 1 1 pt. 2,942

Comments