Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Team South Africa 11. Team South Africa 1 pt. 9,032
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,868
  3. Avatar for Team China 13. Team China 1 pt. 8,842
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 8,815
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,942
  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 67 pts. 10,014
  2. Avatar for WBarme1234 12. WBarme1234 Lv 1 64 pts. 10,002
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 62 pts. 10,001
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 59 pts. 9,994
  5. Avatar for ucad 15. ucad Lv 1 57 pts. 9,988
  6. Avatar for Galaxie 16. Galaxie Lv 1 54 pts. 9,983
  7. Avatar for MicElephant 17. MicElephant Lv 1 52 pts. 9,968
  8. Avatar for equilibria 18. equilibria Lv 1 50 pts. 9,922
  9. Avatar for ProfVince 19. ProfVince Lv 1 47 pts. 9,907
  10. Avatar for Joanna_H 20. Joanna_H Lv 1 45 pts. 9,894

Comments