Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638
  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 67 pts. 10,014
  2. Avatar for WBarme1234 12. WBarme1234 Lv 1 64 pts. 10,002
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 62 pts. 10,001
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 59 pts. 9,994
  5. Avatar for ucad 15. ucad Lv 1 57 pts. 9,988
  6. Avatar for Galaxie 16. Galaxie Lv 1 54 pts. 9,983
  7. Avatar for MicElephant 17. MicElephant Lv 1 52 pts. 9,968
  8. Avatar for equilibria 18. equilibria Lv 1 50 pts. 9,922
  9. Avatar for ProfVince 19. ProfVince Lv 1 47 pts. 9,907
  10. Avatar for Joanna_H 20. Joanna_H Lv 1 45 pts. 9,894

Comments