Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Team South Africa 11. Team South Africa 1 pt. 9,032
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,868
  3. Avatar for Team China 13. Team China 1 pt. 8,842
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 8,815
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,942
  1. Avatar for Merf 31. Merf Lv 1 27 pts. 9,668
  2. Avatar for AlkiP0Ps 32. AlkiP0Ps Lv 1 25 pts. 9,653
  3. Avatar for Oransche 33. Oransche Lv 1 24 pts. 9,638
  4. Avatar for fpc 34. fpc Lv 1 23 pts. 9,632
  5. Avatar for abiogenesis 35. abiogenesis Lv 1 22 pts. 9,619
  6. Avatar for VogSok 36. VogSok Lv 1 21 pts. 9,613
  7. Avatar for manu8170 37. manu8170 Lv 1 20 pts. 9,544
  8. Avatar for Silvercraft 38. Silvercraft Lv 1 19 pts. 9,540
  9. Avatar for heather-1 39. heather-1 Lv 1 18 pts. 9,522
  10. Avatar for Vinara 40. Vinara Lv 1 17 pts. 9,499

Comments