Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638
  1. Avatar for Merf 31. Merf Lv 1 27 pts. 9,668
  2. Avatar for AlkiP0Ps 32. AlkiP0Ps Lv 1 25 pts. 9,653
  3. Avatar for Oransche 33. Oransche Lv 1 24 pts. 9,638
  4. Avatar for fpc 34. fpc Lv 1 23 pts. 9,632
  5. Avatar for abiogenesis 35. abiogenesis Lv 1 22 pts. 9,619
  6. Avatar for VogSok 36. VogSok Lv 1 21 pts. 9,613
  7. Avatar for manu8170 37. manu8170 Lv 1 20 pts. 9,544
  8. Avatar for Silvercraft 38. Silvercraft Lv 1 19 pts. 9,540
  9. Avatar for heather-1 39. heather-1 Lv 1 18 pts. 9,522
  10. Avatar for Vinara 40. Vinara Lv 1 17 pts. 9,499

Comments