Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Team South Africa 11. Team South Africa 1 pt. 9,032
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,868
  3. Avatar for Team China 13. Team China 1 pt. 8,842
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 8,815
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,942
  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 9 pts. 9,198
  2. Avatar for rezaefar 52. rezaefar Lv 1 8 pts. 9,196
  3. Avatar for DScott 53. DScott Lv 1 8 pts. 9,149
  4. Avatar for NickMihal 54. NickMihal Lv 1 7 pts. 9,140
  5. Avatar for mnucer 55. mnucer Lv 1 7 pts. 9,129
  6. Avatar for rinze 56. rinze Lv 1 7 pts. 9,094
  7. Avatar for Wiz kid 57. Wiz kid Lv 1 6 pts. 9,086
  8. Avatar for kludbrook 58. kludbrook Lv 1 6 pts. 9,078
  9. Avatar for maeK 59. maeK Lv 1 5 pts. 9,055
  10. Avatar for Phyx 60. Phyx Lv 1 5 pts. 9,046

Comments