Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638
  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 9 pts. 9,198
  2. Avatar for rezaefar 52. rezaefar Lv 1 8 pts. 9,196
  3. Avatar for DScott 53. DScott Lv 1 8 pts. 9,149
  4. Avatar for NickMihal 54. NickMihal Lv 1 7 pts. 9,140
  5. Avatar for mnucer 55. mnucer Lv 1 7 pts. 9,129
  6. Avatar for rinze 56. rinze Lv 1 7 pts. 9,094
  7. Avatar for Wiz kid 57. Wiz kid Lv 1 6 pts. 9,086
  8. Avatar for kludbrook 58. kludbrook Lv 1 6 pts. 9,078
  9. Avatar for maeK 59. maeK Lv 1 5 pts. 9,055
  10. Avatar for Phyx 60. Phyx Lv 1 5 pts. 9,046

Comments