Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Team South Africa 11. Team South Africa 1 pt. 9,032
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,868
  3. Avatar for Team China 13. Team China 1 pt. 8,842
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 8,815
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,942
  1. Avatar for doctaven 61. doctaven Lv 1 5 pts. 9,032
  2. Avatar for tdesa 62. tdesa Lv 1 4 pts. 9,027
  3. Avatar for zoearj 63. zoearj Lv 1 4 pts. 9,014
  4. Avatar for zbp 64. zbp Lv 1 4 pts. 8,980
  5. Avatar for carxo 65. carxo Lv 1 4 pts. 8,966
  6. Avatar for Bollo 66. Bollo Lv 1 3 pts. 8,932
  7. Avatar for 2021797 67. 2021797 Lv 1 3 pts. 8,909
  8. Avatar for raincloud 68. raincloud Lv 1 3 pts. 8,890
  9. Avatar for Borets 69. Borets Lv 1 3 pts. 8,868
  10. Avatar for Ephraim03 70. Ephraim03 Lv 1 3 pts. 8,862

Comments