Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638
  1. Avatar for doctaven 61. doctaven Lv 1 5 pts. 9,032
  2. Avatar for tdesa 62. tdesa Lv 1 4 pts. 9,027
  3. Avatar for zoearj 63. zoearj Lv 1 4 pts. 9,014
  4. Avatar for zbp 64. zbp Lv 1 4 pts. 8,980
  5. Avatar for carxo 65. carxo Lv 1 4 pts. 8,966
  6. Avatar for Bollo 66. Bollo Lv 1 3 pts. 8,932
  7. Avatar for 2021797 67. 2021797 Lv 1 3 pts. 8,909
  8. Avatar for raincloud 68. raincloud Lv 1 3 pts. 8,890
  9. Avatar for Borets 69. Borets Lv 1 3 pts. 8,868
  10. Avatar for Ephraim03 70. Ephraim03 Lv 1 3 pts. 8,862

Comments